CAS Number: 21215-62-3Molecular Weight: 3417.6Salt Form: TFAPurity: >96%Sequence (3-letter): Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 [Cys1-Cys7]Sequence (1-letter): CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2Storage: -20 °C or below
Calcitonin is a peptide hormone which reduces levels of blood calcium (Ca2+) in opposition of the parathyroid hormone (PTH). It is formed by the proteolytic cleavage of a larger prepropeptide and is excreted by parafollicular cells of the thyroid gland. It is not a significant factor in humans for calcium homeostasis unlike other animals.
Categories | Peptides |
---|
Filter | Calcitonin Gene Peptides |
---|